A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10662 |
| Swiss-prot Accession number | P41585 (Sequence in FASTA format) |
| Description | Glucagon family neuropeptides precursor [Contains: Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide (PACAP)]. |
| Source organism | Oncorhynchus nerka (Sockeye salmon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Primary role of GHRH is to release GH from the pituitary |
| Protein Length | 173 Amino acids |
| Molecular weight | 19704 |
| References | 1 PubMed abstract 8344311 |
| Domain Name | Hormone_2 |
| Hormone Name | Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH) |
| Mature Hormone Sequence | HADGMFNKAYRKALGQLSARKYLHSLMAKRVGGGSTMEDDTEPLS |
| Position of mature hormone in Pre-Hormone protein | 45 Residues from position (82-126) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |