A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10681 |
| Swiss-prot Accession number | P01298 (Sequence in FASTA format) |
| Description | Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide]. |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
| Protein Length | 95 Amino acids |
| Molecular weight | 10445 |
| References | 1 PubMed abstract 6373251 2 PubMed abstract 2997153 3 PubMed abstract 6094571 4 PubMed abstract 3753985 5 PubMed abstract 15489334 6 PubMed abstract 6366786 7 PubMed abstract 15966750 |
| Domain Name | Hormone_3 |
| Hormone Name | Pancreatic hormone |
| Mature Hormone Sequence | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY |
| Position of mature hormone in Pre-Hormone protein | 36 Residues from position (30-65) |
| Receptor | N/A |
| Gene ID | 5539 |
| PDB ID | 1TZ4 1TZ5 |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |