A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10683 |
| Swiss-prot Accession number | P41337 (Sequence in FASTA format) |
| Description | Pancreatic hormone (Pancreatic polypeptide) (PP). |
| Source organism | Larus argentatus (Herring gull) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Charadriiformes; Laridae; Larus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
| Protein Length | 36 Amino acids |
| Molecular weight | 4237 |
| References | 1 PubMed abstract 8174930 |
| Domain Name | Hormone_3 |
| Hormone Name | Pancreatic hormone |
| Mature Hormone Sequence | GPVQPTYPGDDAPVEDLVRFYNDLQQYLNVVTRHRY |
| Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |