| HMRbase accession number | 10687 |
| Swiss-prot Accession number | P01300 (Sequence in FASTA format) |
| Description | Pancreatic hormone precursor (Pancreatic polypeptide) (PP) (Fragment). |
| Source organism | Sus scrofa (Pig) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
| Protein Length | 65 Amino acids |
| Molecular weight | 7290 |
| References | 1 Chance R.E., Johnson M.G., Hoffmann J.A., Lin T.-M.; (In) Baba S., Kaneko T., Yanaihara N. (eds.);Proinsulin, insulin, c-peptide, pp.419-425, Excerpta Medica, Amsterdam(1979).
2 Han X.G., Tuch B.E.; "Partial porcine pancreatic polypeptide cDNA sequence (3'end)."; Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Hormone_3 |
| Hormone Name | Pancreatic hormone |
| Mature Hormone Sequence | APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRY |
| Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
A database of hormones and their receptors