A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10702 |
| Swiss-prot Accession number | P33578 (Sequence in FASTA format) |
| Description | Placental prolactin-like protein D precursor (PRL-like protein D)(PLP-D) (Growth hormone-related protein 1). |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | Secreted protein |
| Developmental Stage | Mid to late gestation (gestation day 15). |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | Placental basal zone cells |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 240 Amino acids |
| Molecular weight | 27270 |
| References | 1 PubMed abstract 8756556 2 PubMed abstract 15489334 3 PubMed abstract 2351117 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin-8A7 |
| Mature Hormone Sequence | IPACLAEEGGCWNPLVETFNSAIHKAETLYDLANQIHVELYQNKFSSEQFSSLNSQVIRKDKTALRAGSYCHSTLINTPNKENEHINIEIKEYVKTLINFVGAWISPLYHLVLELSAMQDVPESILSKAKEIEENNRQLLDDLKWILIKVSPTEEMKEEFPSWGHLSFLKSSGEKSKFLAMFNLSNCLGYDAKYTLLNLRILKCLTTGKDC |
| Position of mature hormone in Pre-Hormone protein | 211 Residues from position (30-240) |
| Receptor | N/A |
| Gene ID | 64368 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |