A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10704 |
| Swiss-prot Accession number | P15743 (Sequence in FASTA format) |
| Description | Parathyroid hormone precursor (PTH). |
| Source organism | Gallus gallus (Chicken) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the parathyroid hormone family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion |
| Protein Length | 119 Amino acids |
| Molecular weight | 13943 |
| References | 1 PubMed abstract 2710135 2 PubMed abstract 3251402 |
| Domain Name | Parathyroid |
| Hormone Name | Parathyroid hormone (Parathyrin) (PTH) |
| Mature Hormone Sequence | SVSEMQLMHNLGEHRHTVERQDWLQMKLQDVHSALEDARTQRPRNKEDIVLGEIRNRRLLPEHLRAAVQKKSIDLDKAYMNVLFKTKP |
| Position of mature hormone in Pre-Hormone protein | 88 Residues from position (32-119) |
| Receptor | N/A |
| Gene ID | 396436 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |