A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10705 |
| Swiss-prot Accession number | Q9GL67 (Sequence in FASTA format) |
| Description | Parathyroid hormone precursor (Parathyrin) (PTH). |
| Source organism | Felis silvestris catus (Cat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis. |
| Subcellular location | Secreted protein (By similarity) |
| Developmental Stage | N/A |
| Similarity | Belongs to the parathyroid hormone family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion |
| Protein Length | 115 Amino acids |
| Molecular weight | 12921 |
| References | 1 Toribio R.E., Kohn C.W., Leone G.W., Capen C.C., Rosol T.J.; "Molecular cloning of feline preproparathyroid hormone."; Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Parathyroid |
| Hormone Name | Parathyroid hormone (Parathyrin) (PTH) |
| Mature Hormone Sequence | SVSEIQFMHNLGKHLSSVERVEWLRRKLQDVHNFVALGAPIAHRDGGSQRPRKKEDNVPAENHQKSLGEADKADVDVLIKAKSQ |
| Position of mature hormone in Pre-Hormone protein | 84 Residues from position (32-115) |
| Receptor | N/A |
| Gene ID | 493684 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |