A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10707 |
| Swiss-prot Accession number | P42692 (Sequence in FASTA format) |
| Description | Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH). |
| Source organism | Cyprinus carpio (Common carp) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
| Protein Length | 45 Amino acids |
| Molecular weight | 4979 |
| References | 1 PubMed abstract 1475012 |
| Domain Name | Hormone_2 |
| Hormone Name | Somatoliberin |
| Mature Hormone Sequence | HADGMFNKAYRKALGQLSARKYLHTLMAKRVGGGSMIEDDNEPLS |
| Position of mature hormone in Pre-Hormone protein | 45 Residues from position (1-45) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |