A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10708 |
| Swiss-prot Accession number | P01242 (Sequence in FASTA format) |
| Description | Growth hormone variant precursor (GH-V) (Placenta-specific growthhormone) (Growth hormone 2). |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | Expressed in the placenta |
| Post translational modification | N/A |
| Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
| Protein Length | 217 Amino acids |
| Molecular weight | 25000 |
| References | 1 PubMed abstract 7169009 2 PubMed abstract 3379057 3 PubMed abstract 2460050 4 PubMed abstract 2744760 5 PubMed abstract 15489334 6 PubMed abstract 2196278 7 PubMed abstract 10393484 |
| Domain Name | Hormone_1 |
| Hormone Name | Growth hormone 2 (Placenta-specific growth hormone) (GH-V) |
| Mature Hormone Sequence | FPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
| Position of mature hormone in Pre-Hormone protein | 191 Residues from position (27-217) |
| Receptor | N/A |
| Gene ID | 2689 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |