A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10709 |
| Swiss-prot Accession number | Q07370 (Sequence in FASTA format) |
| Description | Growth hormone variant precursor (GH-V) (Placenta-specific growthhormone) (Growth hormone 2). |
| Source organism | Macaca mulatta (Rhesus macaque) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
| Subcellular location | Secreted protein (By similarity) |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | Expressed in the placenta |
| Post translational modification | N/A |
| Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
| Protein Length | 217 Amino acids |
| Molecular weight | 25221 |
| References | 1 Golos T.G.; Submitted (JAN-1994) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 8404617 |
| Domain Name | Hormone_1 |
| Hormone Name | Growth hormone variant |
| Mature Hormone Sequence | FPTIPLSWLFNTAVFRAHHLHKLAFDTYPKLEEAYIPKEQKYSFLRNPQTSLCFSESIPTPSNKEETQQKSNLELLHISLLLIQSWLEPVQFLRSVFANHLVHTNSNFDIYLYLKKLEEGIQTLMERLEDGSPRTGQIFKETYSKYDTNSHNDDTLLKNYRLLYCFRKDMNKVETFLRTVRCRAVEGSCGF |
| Position of mature hormone in Pre-Hormone protein | 191 Residues from position (27-217) |
| Receptor | N/A |
| Gene ID | 700885 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |