A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10713 |
| Swiss-prot Accession number | P09538 (Sequence in FASTA format) |
| Description | Somatotropin 1 precursor (Growth hormone 1). |
| Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 210 Amino acids |
| Molecular weight | 23795 |
| References | 1 PubMed abstract 2908440 2 PubMed abstract 2647438 3 PubMed abstract 3545720 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin-1 (Somatotropin I) (Growth hormone I) |
| Mature Hormone Sequence | IENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL |
| Position of mature hormone in Pre-Hormone protein | 188 Residues from position (23-210) |
| Receptor | N/A |
| Gene ID | 100136733 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |