A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10714 |
| Swiss-prot Accession number | P12855 (Sequence in FASTA format) |
| Description | Somatotropin A precursor (Growth hormone A) (GH-A). |
| Source organism | Xenopus laevis (African clawed frog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control |
| Protein Length | 214 Amino acids |
| Molecular weight | 24700 |
| References | 1 PubMed abstract 10618393 2 PubMed abstract 2734108 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin-A |
| Mature Hormone Sequence | FPSVPLFSLFTNAVSRAQYIHMLAADTYRDYERTYITDEQRHSNKNSHVVSCYSETIPYPTDKDNTHQKSDLELLRFSLNLIQSWLNPVQALNKVFSNNLVFGSSDVYERLKYLEEGIQALMQELEDGSFRSFPFLRPPYERFDINLRSDDALVKVYGLLSCFKKDMHKVETYLKVMKCRRFVESNCTI |
| Position of mature hormone in Pre-Hormone protein | 189 Residues from position (26-214) |
| Receptor | N/A |
| Gene ID | 399154 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |