A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10721 |
| Swiss-prot Accession number | P33092 (Sequence in FASTA format) |
| Description | Somatotropin (Growth hormone). |
| Source organism | Balaenoptera borealis (Sei whale) (Pollack whale) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
| Protein Length | 190 Amino acids |
| Molecular weight | 21835 |
| References | 1 PubMed abstract 7115813 2 Osipova T.A., Bulatov A.A., Pankov Y.A.; "Structural studies of tryptic peptides from large cyanogen bromidefragments of sei whale (Balalnoptera borealis) somatotropin."; Bioorg. Khim. 4:1589-1599(1978). |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | FPAMPLSSLFANAVLRAQHLHELAADTYKEFERAYIPEGQRYFLQNAQSTGCFSEVIPTPANKDEAQQRSDVELLRFSLLLIQSWLGPVQFLEKAYANELVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF |
| Position of mature hormone in Pre-Hormone protein | 190 Residues from position (1-190) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |