A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10724 |
| Swiss-prot Accession number | O73849 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Bufo marinus (Giant toad) (Cane toad) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Hyloidea; Bufonidae; Bufo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control |
| Protein Length | 213 Amino acids |
| Molecular weight | 24556 |
| References | 1 May D., Alrubaian J., Patel S., Dores R.M., Rand-Weaver M.; "Studies on the GH/SL gene family: cloning of African lungfish(Protopterus annectens) growth hormone and somatolactin and toad (Bufomarinus) growth hormone."; Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | FPQIPLASLLNNAVIRAQYIRQVVADTYRDYEQTFIREDKRYSNKNSYAMFCYSETIPAPTDKDNTHQKSDIDLLRFSLTLIQSWMTPVQSLNKLFTNQVFGNAVYEKLRDLEEGLYALMRELDDGNARNYGLLTFTYDKFDPHPDSDDDGRIKNYGLLSCFKKDMHKVETYLKVMKCRRFVESNCMV |
| Position of mature hormone in Pre-Hormone protein | 188 Residues from position (26-213) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |