A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10729 |
| Swiss-prot Accession number | P34005 (Sequence in FASTA format) |
| Description | Somatotropin (Growth hormone). |
| Source organism | Chelonia mydas (Green sea-turtle) (Chelonia agassizi) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Chelonioidea; Cheloniidae; Chelonia. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 191 Amino acids |
| Molecular weight | 22050 |
| References | 1 PubMed abstract 2707583 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | AFPAMPLSSLFANAVLRAQHLHLLAADTYKEFERTYIPEEQRHSNKISQSASCYSETIPAPTGKDDAEQKSDMELLRFSLILIQSWLNPVQFLSRVFTNSLVFGTSDRVYEKLRDLEEGIQALMRELEDGSLRGFQVLRPTYDKFDINLRNEDALLKNYGLLSCFKKDLHKVETYLKLMKCRRFGESNCTI |
| Position of mature hormone in Pre-Hormone protein | 191 Residues from position (1-191) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |