A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10741 |
| Swiss-prot Accession number | P69160 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Hypophthalmichthys nobilis (Bighead carp) (Aristichthys nobilis) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Hypophthalmichthys. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control |
| Protein Length | 210 Amino acids |
| Molecular weight | 23580 |
| References | 1 PubMed abstract 1426941 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | ENQRLFNNAVIRVQHLHQLAAKMINDFEDNLLPEERRQLSKIFPLSFCNSDSIEAPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSGAVSNSLTVGNPNQITEKLADLKVGISVLIKGCLDGQPNMDDNDSLPLPFEDFYLTMGESSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL |
| Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |