A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10749 |
| Swiss-prot Accession number | P19795 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Mustela vison (American mink) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Mustela. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
| Protein Length | 216 Amino acids |
| Molecular weight | 24469 |
| References | 1 PubMed abstract 2243786 2 Perelygina L.M., Baricheva E.M., Sebeleva T.E., Kokoza V.A.; Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 2268323 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | FPAMPLSSLFANAVLRAQHLHQLAADTYKDFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGPILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF |
| Position of mature hormone in Pre-Hormone protein | 190 Residues from position (27-216) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |