A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10756 |
| Swiss-prot Accession number | P69161 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Pangasius pangasius (Catfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Pangasiidae; Pangasius. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 200 Amino acids |
| Molecular weight | 22562 |
| References | 1 Lemaire C., Panyim S.; "Molecular cloning and DNA sequencing of growth hormone gene of thefish, Pangasius pangasius."; Submitted (FEB-1992) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | ATFENQRLFNNAVIRVQHLHQLAAKMMDDFEEALLPEERKQLSKIFPLSFCNSDSIEAPAGKDETQKSSVLKLLHTSYRLIESWEFPSKNLGNPNHISEKLADLKMGIGVLIEGCLDGQTSLDENDSLAPPFEDFYQTLSEGNLRKSFRLLSCFKKDMHKVETYLSVAKCRRSLDSNCTL |
| Position of mature hormone in Pre-Hormone protein | 178 Residues from position (23-200) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |