A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10760 |
| Swiss-prot Accession number | P34006 (Sequence in FASTA format) |
| Description | Somatotropin (Growth hormone). |
| Source organism | Prionace glauca (Blue shark) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Galeomorphii; Galeoidea; Carcharhiniformes;Carcharhinidae; Prionace. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 183 Amino acids |
| Molecular weight | 21071 |
| References | 1 PubMed abstract 2707584 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | YPLLPLSDLFAKAVHRAQHLHLVAAETTKDFERKYIPEEQRHSHKSSPSAFCQSETIPAPTGKEDAQQRSDRELLLYSLLLIQSWLNPIQNLSAFRTSDRVYDKLRDLEEGIFALMKTLEDGGSSQGFAWLKFSYERFDGNLSEEALMKNYGLLACFKKDMHKVETYLKVMNCKRFAESNCTV |
| Position of mature hormone in Pre-Hormone protein | 183 Residues from position (1-183) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |