A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10762 |
| Swiss-prot Accession number | P10813 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Rana catesbeiana (Bull frog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
| Subcellular location | Secreted protein |
| Developmental Stage | Levels increase as metamorphosis progresses, reach maxima in juveniles and decrease as adulthood approaches. |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control |
| Protein Length | 215 Amino acids |
| Molecular weight | 24975 |
| References | 1 PubMed abstract 3260110 2 PubMed abstract 1476615 3 PubMed abstract 1859828 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | FPQMSLSNLFTNAVIRAQHLHQMVADTYRDYERTYIPEDQRFSNKHSYSVYCYSETIPAPTDKDNTHQKSDIDLLRFSLTLLQSWMTPIQIVNRVFGNNQVFGNIDRVYDRLRDLDEGLHILIRELDDGNVRNYGVLTFTYDKFDVNLRSEEGRAKNYGLLSCFKKDMHKVETYLKVMKCRRFVESNCTF |
| Position of mature hormone in Pre-Hormone protein | 190 Residues from position (26-215) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |