A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10766 |
| Swiss-prot Accession number | P45643 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Solea senegalensis (Sole) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Soleoidei; Soleidae; Solea. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 203 Amino acids |
| Molecular weight | 23238 |
| References | 1 PubMed abstract 8056337 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | QSILDQRRFSIAVSRVQHIHLLAQKYFSDFESSLQTEDQRQVNKIFLQDFCNSDDIISPIDKHDTQRSSVLKLLSISVRLIESWEFSSRFVTWSTFPRNQISHKLSELKTGIRMLIEANQDGAEVFSDSSTFQLAPYGNFYQSLGGDESLRRNYELLACFKKDMHKVETYLTVAKCRLSPEANCTL |
| Position of mature hormone in Pre-Hormone protein | 186 Residues from position (18-203) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |