A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10769 |
| Swiss-prot Accession number | P34747 (Sequence in FASTA format) |
| Description | Somatotropin (Growth hormone). |
| Source organism | Thunnus albacares (Yellowfin tuna) (Neothunnus macropterus) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 187 Amino acids |
| Molecular weight | 21305 |
| References | 1 Kariya Y., Sato N., Kawazoe I., Kimura S., Miyazaki N., Nonaka M.,Kawauchi H.; "Isolation and characterization of growth hormone from a marine fish,tuna (Thunnus albacares)."; Agric. Biol. Chem. 53:1679-1687(1989).
|
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | QPITDSQRLFSIAVSRIQHLHLLAQRLFSDFESSLQTEEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYRLVQSWEFPSRSLSGGSALRNQISPKLSELKTGIHLLIRANQDGAEMFADSSALQLAPYGNYYQSLGADESLRRSYELLACFKKDMHKVETYLTVAKCRLSPEANCTL |
| Position of mature hormone in Pre-Hormone protein | 187 Residues from position (1-187) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |