A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10772 |
| Swiss-prot Accession number | O93566 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Verasper variegatus (Spotted flounder) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Verasper. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 203 Amino acids |
| Molecular weight | 23143 |
| References | 1 Lee J.H., Lee S.J., Kim Y., Jeon I.G., Kim K.K., Kim K.W.; "Molecular cloning of the spotted flounder (Verasper variegatus)growth hormone cDNA by polymerase chain reaction."; Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | QPITENQRLFSIAVGRVQYLHLVAKKLFSEFENSQLEDQHPLNKIFLQDFCHSDYFLSPIDKHETQRSSVLKLLSISYRLIECWEFSSRFLVAGFAERAQVTSKLSELKTGLMKLIEANQDGAGGFSESSVIQLTPYGNYYQSVGVDESFRLNYELFACFKKDMHKVETYLTVAKCRLSPEANCTL |
| Position of mature hormone in Pre-Hormone protein | 186 Residues from position (18-203) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |