A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10779 |
| Swiss-prot Accession number | Q95J88 (Sequence in FASTA format) |
| Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
| Source organism | Monodelphis domestica (Short-tailed gray opossum) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Indispensable for the control of thyroid structure and metabolism |
| Protein Length | 138 Amino acids |
| Molecular weight | 15398 |
| References | 1 Kacsoh B.; "Cloning and characterization of the cDNA encoding pituitary thyroidstimulating hormone (TSH, thyrotropin) beta of the marsupial,Monodelphis domestica."; Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Cys_knot |
| Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
| Mature Hormone Sequence | LCVPTGYTMHIERRECAYCLTINTTICAGYCMTRDSNGKLFLPKSALSQDVCTYRDVIYRTVVMPGCPPHVIPYISYPVAVSCRCGKCNTDYIDCIHESVTTNYCTKPQKPY |
| Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
| Receptor | N/A |
| Gene ID | 503501 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |