A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10781 |
| Swiss-prot Accession number | O73824 (Sequence in FASTA format) |
| Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
| Source organism | Salmo salar (Atlantic salmon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Salmo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes |
| Protein Length | 139 Amino acids |
| Molecular weight | 15449 |
| References | 1 Martin S.A.M., Wallner W., Youngson A.F., Smith T.; "Differential expression of Atlantic salmon (Salmo salar) thyrotropinbeta subunit mRNA and its cDNA sequence."; J. Fish Biol. 54:757-766(1998).
|
| Domain Name | Cys_knot |
| Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
| Mature Hormone Sequence | MCVPTDYTLYEERRECDFCVAINTTICMGFCYSRDSNMKELAGPRFLIQRGCTYDQVEYRTVILPGCPLHANPLFTYPVALSCHCGTCNTDSDECAHKASSGDGARCSKPLRHIYHTLA |
| Position of mature hormone in Pre-Hormone protein | 119 Residues from position (21-139) |
| Receptor | N/A |
| Gene ID | 100136355 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |