A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10800 |
| Swiss-prot Accession number | P01317 (Sequence in FASTA format) |
| Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
| Protein Length | 105 Amino acids |
| Molecular weight | 11393 |
| References | 1 PubMed abstract 2456452 2 PubMed abstract 4928892 3 PubMed abstract 14886311 4 PubMed abstract 5545080 5 PubMed abstract 5105368 6 PubMed abstract 13032079 7 PubMed abstract 13249947 8 Smith G.D., Duax W.L., Dodson E.J., Dodson G.G., de Graaf R.A.G.,Reynolds C.D.; "The structure of des-Phe b1 bovine insulin."; Acta Crystallogr. B 38:3028-3032(1982). 9 PubMed abstract 9141131 |
| Domain Name | Insulin |
| Hormone Name | Insulin B chain |
| Mature Hormone Sequence | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
| Position of mature hormone in Pre-Hormone protein | 30 Residues from position (25-54) |
| Receptor | N/A |
| Gene ID | 280829 |
| PDB ID | 1APH 1BPH 1CPH 1DPH 1HO0 1PID 2A3G 2BN1 2BN3 2INS |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |