| HMRbase accession number | 10818 |
| Swiss-prot Accession number | P67970 (Sequence in FASTA format) |
| Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
| Source organism | Gallus gallus (Chicken) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
| Protein Length | 107 Amino acids |
| Molecular weight | 11981 |
| References | 1 PubMed abstract 7388949 2 Hasegawa S., Honda K., Nata K., Yonekura H., Okamoto H., Hikami Y.; "Isolation of a cDNA encoding chicken insulin precursor."; Anim. Sci. Technol. 62:867-869(1991).
3 Nie Q., Fang M., Sun B., Lei M., Zhang X.; "Complete coding region of chicken preproinsulin gene."; Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases.
4 PubMed abstract 5949593
|
| Domain Name | Insulin |
| Hormone Name | Insulin B chain |
| Mature Hormone Sequence | AANQHLCGSHLVEALYLVCGERGFFYSPKA |
| Position of mature hormone in Pre-Hormone protein | 30 Residues from position (25-54) |
| Receptor | N/A |
| Gene ID | 396145 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |