A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10952 |
| Swiss-prot Accession number | P11885 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Rana catesbeiana (Bull frog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | N/A |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | N/A |
| Protein Length | 263 Amino acids |
| Molecular weight | 30389 |
| References | 1 PubMed abstract 2788269 2 PubMed abstract 1331997 3 PubMed abstract 2788269 4 PubMed abstract 1331997 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Corticotropin |
| Mature Hormone Sequence | SYSMEHFRWGKPVGKKRRPIKVFPTDAEEESSESFPIEL |
| Position of mature hormone in Pre-Hormone protein | 39 Residues from position (144-182) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |