A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10975 |
| Swiss-prot Accession number | P01196 (Sequence in FASTA format) |
| Description | Corticotropin (Adrenocorticotropic hormone) (ACTH) [Contains:Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP)]. |
| Source organism | Struthio camelus (Ostrich) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | ACTH stimulates the adrenal glands to release cortisol |
| Protein Length | 39 Amino acids |
| Molecular weight | 4626 |
| References | 1 PubMed abstract 208539 2 PubMed abstract 208539 |
| Domain Name | ACTH_domain |
| Hormone Name | Corticotropin |
| Mature Hormone Sequence | SYSMEHFRWGKPVGRKRRPVKVYPNGVQEETSEGFPLEF |
| Position of mature hormone in Pre-Hormone protein | 39 Residues from position (1-39) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |