A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10978 |
| Swiss-prot Accession number | Q9YGK2 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin]. |
| Source organism | Thunnus obesus (Bigeye tuna) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | N/A |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | N/A |
| Protein Length | 222 Amino acids |
| Molecular weight | 24970 |
| References | 1 Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases.
2 Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Lipotropin beta (Beta-LPH) |
| Mature Hormone Sequence | ELASELLAAAEEEEEKAQEVMAEEEEEQKQLLQEKKDGSYKMKHFRWSGPPASKRYGGFMKSWDERSQRPLLTLFKNVINKDGQQQK |
| Position of mature hormone in Pre-Hormone protein | 87 Residues from position (136-222) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |