A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11006 |
| Swiss-prot Accession number | Q7ZZV3 (Sequence in FASTA format) |
| Description | Prolactin precursor (PRL). |
| Source organism | Anguilla japonica (Japanese eel) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 209 Amino acids |
| Molecular weight | 23155 |
| References | 1 Han Y.-S., Yu J.Y.-L., Liao I.-C., Tzeng W.-N.; "Salinity preference of the silvering Japanese eel Anguilla japonica:evidences from the pituitary prolactin mRNA levels and otolithstrontium/calcium ratios."; Mar. Ecol. Prog. Ser. 259:253-261(2003).
|
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | VGLGDMLERASQLSDKLHSLSTSLTNDLDTHFPPMGKILMPRPSMCHTASLQTPHDKDQALRVPESELLSLARALLLSWNDPLLLLTSEAPTLSHPQNGVIYSKTRELQDQSNSLSSGLDRLIHKIGSSSKSLSPLPFQGGDLGSDKNSRLINFYFLLSCFRRDSHKIDNFLKLLRCRAAKQDRC |
| Position of mature hormone in Pre-Hormone protein | 185 Residues from position (25-209) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |