A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11009 |
| Swiss-prot Accession number | P33090 (Sequence in FASTA format) |
| Description | Prolactin (PRL). |
| Source organism | Chelonia mydas (Green sea-turtle) (Chelonia agassizi) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Chelonioidea; Cheloniidae; Chelonia. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | Pituitary gland |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 198 Amino acids |
| Molecular weight | 22606 |
| References | 1 PubMed abstract 2289679 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | LPICPSGSVGCQVSLENLFDRAVKLSHYIHSLSSEMFNEFDERYAQGRGFLTKAINGCHTSSLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVSEVQSIKEAPDTILKAVEIEEQDKRLLEGMEKIVGQVHPGEIENELYSPWSGLPSLQQVDEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRLIHDNDC |
| Position of mature hormone in Pre-Hormone protein | 198 Residues from position (1-198) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |