A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11017 |
| Swiss-prot Accession number | P51904 (Sequence in FASTA format) |
| Description | Prolactin precursor (PRL). |
| Source organism | Ictalurus punctatus (Channel catfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Ictaluridae; Ictalurus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | Pituitary gland |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 212 Amino acids |
| Molecular weight | 23366 |
| References | 1 Tang Y.; "A study on the channel catfish (Ictalurus punctatus) growth hormonegene family: structures of growth hormone and prolactin genes andsomatolactin cDNA, their evolutionary implications and expression inthe pituitary gland."; Thesis (1993), University of Maryland, United States.
2 PubMed abstract 1308206 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | VNLNDLLDRASQLSDKMHSLSTSLTNDLDSHFSSVGGKLMRPSMCHTSSLQIPNDKDQALSVPEGELLSLVRSLLMAWSDPLALLSSEATSLPHPERNSINTKTRELQDHTNSLGAGLERLGRKMGSSPESLSSLPFNSNDLGQDNISRLVNFHFLLSCFRRDSHKIDSFLKVLRCDAAKMLPEMC |
| Position of mature hormone in Pre-Hormone protein | 186 Residues from position (27-212) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |