A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11020 |
| Swiss-prot Accession number | P37884 (Sequence in FASTA format) |
| Description | Prolactin precursor (PRL). |
| Source organism | Mesocricetus auratus (Golden hamster) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Mesocricetus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Prolactin acts primarily on the mammary gland by promoting lactation |
| Protein Length | 226 Amino acids |
| Molecular weight | 25582 |
| References | 1 PubMed abstract 1954881 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | LPICPGGNCQMPLQELFDRVIMLSHYIYMLSADMFIELDKQYAQDHEFIAKAISDCPTSSLATPEGKEEAQQVPPEVLLNLILSLVHSWNDPLFQLVTEVDGIHEASDAIISRAKEIGEQNKRLLEGIEKILGQAYPEAKGNEIYSVWSQFPSLQGVDEESRDLAIYNKVRCLRRDSHKVDNYLKLLRCRVVHNNNC |
| Position of mature hormone in Pre-Hormone protein | 197 Residues from position (30-226) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |