A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11022 |
| Swiss-prot Accession number | P29234 (Sequence in FASTA format) |
| Description | Prolactin precursor (PRL). |
| Source organism | Mustela vison (American mink) (Neovison vison) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Prolactin acts primarily on the mammary gland by promoting lactation |
| Protein Length | 229 Amino acids |
| Molecular weight | 26194 |
| References | 1 Vardy T.L., Farid A.; "Nucleotide sequence variation of the mink preprolactin gene."; Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 8307350 3 Bondar A.A., Golovin S.J., Mertvetsov N.P.; "Nucleotide sequence of mink prolactin mRNA from pituitary."; Sibirskii Biol. Zh. 2:10-15(1993). |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | LPICPTGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPDSILSRAIEIEEQNRRLLEGMEKIVGQVHPGVRENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC |
| Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |