A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11026 |
| Swiss-prot Accession number | O93337 (Sequence in FASTA format) |
| Description | Prolactin precursor (PRL). |
| Source organism | Sparus aurata (Gilthead sea bream) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Sparidae; Sparus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 212 Amino acids |
| Molecular weight | 23338 |
| References | 1 PubMed abstract 10094859 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | VPINDLLDRASQRSDMLHSLSTTLTKDLSNHVPPVGWTMMPRPPLCHTSSLQTPNDKEQALQLSESDLMSLARSLLQAWQDPLVDLSNSANSLLHPSQSSISNKIRELQEHSKSLGDGLDILSGKMGPAAQAISSLPYRGSNDIGEDNISKLTNFHFLLSCFRRDSHKIDSFLKVLRCRAAKVQPEMC |
| Position of mature hormone in Pre-Hormone protein | 188 Residues from position (25-212) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |