A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11027 |
| Swiss-prot Accession number | O62781 (Sequence in FASTA format) |
| Description | Prolactin precursor (PRL). |
| Source organism | Trichosurus vulpecula (Brush-tailed possum) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Phalangeridae; Trichosurus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Prolactin acts primarily on the mammary gland by promoting lactation, mammogenesis, mitogenesis and osmoregulation |
| Protein Length | 228 Amino acids |
| Molecular weight | 26097 |
| References | 1 PubMed abstract 9653022 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | LPICPSGAVNCQVSLSDLFDRAVMLSHYIHSPSSEMFNEFDERYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVTEVRSMQEAPDTILSKAMEIEEQNKRLLEGMEKIVGQVHPGDRENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRLIHDSNC |
| Position of mature hormone in Pre-Hormone protein | 199 Residues from position (30-228) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |