A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11049 |
| Swiss-prot Accession number | P21753 (Sequence in FASTA format) |
| Description | Thymosin beta-10 (Thymosin beta-9). |
| Source organism | Sus scrofa (Pig) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
| Subcellular location | Cytoplasm |
| Developmental Stage | N/A |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Protein Length | 42 Amino acids |
| Molecular weight | 4823 |
| References | 1 Cai G., Chen Y., Wang C., Li J., Peng G., Zhang H.; "Generation and analysis of cDNA sequences derived from a porcineskeletal muscle library."; Submitted (MAY-2006) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 2774558 3 PubMed abstract 2090639 |
| Domain Name | Thymosin |
| Hormone Name | Thymosin beta-10 |
| Mature Hormone Sequence | ADKPDMGEINSFDKAKLKKTETQEKNTLPTKETIEQEKQAK |
| Position of mature hormone in Pre-Hormone protein | 41 Residues from position (2-42) |
| Receptor | N/A |
| Gene ID | 100037998 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |