A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11052 |
| Swiss-prot Accession number | P33248 (Sequence in FASTA format) |
| Description | Thymosin beta-12. |
| Source organism | Lateolabrax japonicus (Japanese sea perch) (Japanese sea bass) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Moronidae; Lateolabrax. |
| Subcellular location | Cytoplasm |
| Developmental Stage | N/A |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Protein Length | 44 Amino acids |
| Molecular weight | 4910 |
| References | 1 PubMed abstract 1731637 |
| Domain Name | Thymosin |
| Hormone Name | Thymosin beta-12 |
| Mature Hormone Sequence | SDKPDISEVTSFDKTKLKKTETQEKNPLPSKETIEQEKAAATS |
| Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |