A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11053 |
| Swiss-prot Accession number | P26352 (Sequence in FASTA format) |
| Description | Thymosin beta-12. |
| Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Cytoplasm |
| Developmental Stage | N/A |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Protein Length | 43 Amino acids |
| Molecular weight | 4891 |
| References | 1 PubMed abstract 1575682 2 Echner H., Yialouris P.P., Haritos A.A., Gruebler G., Voelter W.; "Structure and syntheses of thymosin beta-11 and beta-12."; (In) Schneider C.H., Eberles A.N. (eds.);Peptides 1992, pp.751-752, Escom Science Publishers, Leiden (1993). |
| Domain Name | Thymosin |
| Hormone Name | Thymosin beta-12 |
| Mature Hormone Sequence | SDKPDLAEVSNFDKTKLKKTETQEKNPLPTKETIEQEKQATA |
| Position of mature hormone in Pre-Hormone protein | 42 Residues from position (2-43) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |