A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11054 |
| Swiss-prot Accession number | O14604 (Sequence in FASTA format) |
| Description | Thymosin beta-4, Y-chromosomal. |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Cytoplasm (By similarity) |
| Developmental Stage | N/A |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | Ubiquitous |
| Post translational modification | N/A |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Protein Length | 44 Amino acids |
| Molecular weight | 5013 |
| References | 1 PubMed abstract 9381176 2 PubMed abstract 12815422 3 PubMed abstract 15489334 |
| Domain Name | Thymosin |
| Hormone Name | Thymosin beta-4 |
| Mature Hormone Sequence | SDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES |
| Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
| Receptor | N/A |
| Gene ID | 100130227 9087 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |