A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11055 |
| Swiss-prot Accession number | P62326 (Sequence in FASTA format) |
| Description | Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)]. |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | Cytoplasm |
| Developmental Stage | N/A |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Protein Length | 44 Amino acids |
| Molecular weight | 5053 |
| References | 1 Yu J., Meng Y., Wang Z., Hansen C., Li C., Moore S.S.; "Analysis of sequences obtained from constructed full-length bovinecDNA libraries."; Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases.
2 Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 6940133 4 PubMed abstract 2915977 5 PubMed abstract 2253778 6 PubMed abstract 1551869 7 PubMed abstract 2261438 8 PubMed abstract 8269922 |
| Domain Name | Thymosin |
| Hormone Name | Thymosin beta-4 |
| Mature Hormone Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
| Receptor | N/A |
| Gene ID | 781334 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |