A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11061 |
| Swiss-prot Accession number | P20065 (Sequence in FASTA format) |
| Description | Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | Cytoplasm |
| Developmental Stage | N/A |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | Originally found in thymus but it is widely distributed in many tissues |
| Post translational modification | N/A |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Protein Length | 50 Amino acids |
| Molecular weight | 5679 |
| References | 1 PubMed abstract 2351831 2 PubMed abstract 2226839 3 PubMed abstract 8838802 |
| Domain Name | Thymosin |
| Hormone Name | Thymosin beta-4 |
| Mature Hormone Sequence | MLLPATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Position of mature hormone in Pre-Hormone protein | 50 Residues from position (1-50) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | 1T44 |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |