A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11063 |
| Swiss-prot Accession number | P34032 (Sequence in FASTA format) |
| Description | Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)]. |
| Source organism | Oryctolagus cuniculus (Rabbit) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
| Subcellular location | Cytoplasm |
| Developmental Stage | N/A |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | Originally found in thymus but it is widely distributed in many tissues |
| Post translational modification | N/A |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Protein Length | 44 Amino acids |
| Molecular weight | 5037 |
| References | 1 PubMed abstract 6838210 |
| Domain Name | Thymosin |
| Hormone Name | Thymosin beta-4 |
| Mature Hormone Sequence | ADKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |