A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11066 |
| Swiss-prot Accession number | P18758 (Sequence in FASTA format) |
| Description | Thymosin beta-4 (T beta 4) (Thymosin beta 4Xen). |
| Source organism | Xenopus laevis (African clawed frog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
| Subcellular location | Cytoplasm |
| Developmental Stage | N/A |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | Spleen, kidney, heart, and oocytes |
| Post translational modification | N/A |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Protein Length | 44 Amino acids |
| Molecular weight | 5097 |
| References | 1 PubMed abstract 1567461 2 PubMed abstract 3124756 |
| Domain Name | Thymosin |
| Hormone Name | Thymosin beta-4 |
| Mature Hormone Sequence | SDKPDMAEIEKFDKAKLKKTETQEKNPLPSKETIEQEKQTSES |
| Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
| Receptor | N/A |
| Gene ID | 399438 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |