A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11067 |
| Swiss-prot Accession number | Q9DET5 (Sequence in FASTA format) |
| Description | Thymosin beta. |
| Source organism | Coturnix coturnix japonica (Japanese quail) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Coturnix. |
| Subcellular location | Cytoplasm (By similarity) |
| Developmental Stage | N/A |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Protein Length | 45 Amino acids |
| Molecular weight | 5245 |
| References | 1 Dathe V.E., Prols F., Brand-Saberi B.; Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Thymosin |
| Hormone Name | Thymosin beta |
| Mature Hormone Sequence | CDKPDLSEVEKFDKKKLKKTNTEEKNTLPSKETIEQEKECVKSS |
| Position of mature hormone in Pre-Hormone protein | 44 Residues from position (2-45) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |