A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11072 |
| Swiss-prot Accession number | P07449 (Sequence in FASTA format) |
| Description | Glucagon-1 precursor [Contains: Glucagon-1; Glucagon-like peptide 1-1](Fragment). |
| Source organism | Oncorhynchus kisutch (Coho salmon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 68 Amino acids |
| Molecular weight | 7819 |
| References | 1 PubMed abstract 3520699 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-like peptide 1-1 |
| Mature Hormone Sequence | HADGTYTSNVSTYLQDQAAKDFVSWLKSGRA |
| Position of mature hormone in Pre-Hormone protein | 31 Residues from position (38-68) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |