A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11074 |
| Swiss-prot Accession number | P04092 (Sequence in FASTA format) |
| Description | Glucagon-2 precursor (Glucagon II) [Contains: Glicentin-relatedpolypeptide (GRPP); Glucagon-2 (Glucagon II); Glucagon-like peptide 2(Glucagon-like peptide II)]. |
| Source organism | Lophius americanus (American goosefish) (Anglerfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Lophiiformes; Lophiidae; Lophius. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 122 Amino acids |
| Molecular weight | 14171 |
| References | 1 PubMed abstract 6338015 2 PubMed abstract 3526301 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-like peptide 2 |
| Mature Hormone Sequence | HADGTYTSDVSSYLQDQAAKDFVSWLKAGRG |
| Position of mature hormone in Pre-Hormone protein | 31 Residues from position (89-119) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |