A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11077 |
| Swiss-prot Accession number | P33528 (Sequence in FASTA format) |
| Description | Glucagon precursor [Contains: Glucagon; Glucagon-like peptide](Fragments). |
| Source organism | Amia calva (Bowfin) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Amiiformes; Amiidae; Amia. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 75 Amino acids |
| Molecular weight | 8861 |
| References | 1 PubMed abstract 8240302 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-like peptide |
| Mature Hormone Sequence | YADAPYISDVYSYLQDQVAKKWLKSGQDRRE |
| Position of mature hormone in Pre-Hormone protein | 31 Residues from position (45-75) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |