A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11084 |
| Swiss-prot Accession number | P29794 (Sequence in FASTA format) |
| Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
| Source organism | Canis familiaris (Dog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain |
| Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity). |
| Function | Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity |
| Protein Length | 180 Amino acids |
| Molecular weight | 21115 |
| References | 1 PubMed abstract 11916259 2 PubMed abstract 3238052 3 PubMed abstract 10499540 4 PubMed abstract 12554744 5 PubMed abstract 12626323 6 PubMed abstract 10322410 7 PubMed abstract 10605628 |
| Domain Name | Hormone_2 |
| Hormone Name | Glicentin |
| Mature Hormone Sequence | RSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Position of mature hormone in Pre-Hormone protein | 69 Residues from position (21-89) |
| Receptor | N/A |
| Gene ID | 403571 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |